| Edit |   |
| Antigenic Specificity | COBLL1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The COBLL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to COBLL1. This antibody reacts with human. The COBLL1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to COBLL1(COBL-like 1) The peptide sequence was selected from the middle region of COBLL1. Peptide sequence QAKPSSFFLQMQKRVSGHYVTSAAAKSVHAAPNPAPKELTNKEAERDMLP. |
| Other Names | COBL-like 1, COBLR1, cordon-bleu protein-like 1 |
| Gene, Accession # | COBLL1, Gene ID: 22837, Accession: Q53SF7, SwissProt: Q53SF7 |
| Catalog # | NBP1-70505-20ul |
| Price | |
| Order / More Info | COBLL1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |