| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | COCO/DAND5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The COCO/DAND5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to COCO/DAND5. This antibody reacts with human. The COCO/DAND5 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human COCO/DAND5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GMCKAVPFVQVFSRPGCSAIRLRNHLCFGHCSSLYIPGSDPTPLVLCNSC MPARKRWAPVVLWCLTGSSASRRRVKISTMLIEGCHCSPKA |
|---|
| Other Names | CER2CRL2, cerberus-like 2, Cerberus-like protein 2, cerl-2, CERL2, CKTSF1B3MGC126849, COCO, Cysteine knot superfamily 1, BMP antagonist 3, DAN domain family member 5, DAN domain family, member 5, DANTE, DTE, FLJ38607, GREM3cerberus 2, Gremlin-3, SP1 |
|---|
| Gene, Accession # | DAND5, Gene ID: 199699 |
|---|
| Catalog # | NBP2-13899 |
|---|
| Price | |
|---|
| Order / More Info | COCO/DAND5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|