| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ARMER |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ARMER Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARMER. This antibody reacts with human. The ARMER Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ARMER antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEE |
|---|
| Other Names | ADP-ribosylation factor-like 6 interacting protein, ADP-ribosylation factor-like 6 interacting protein 1, Aip-1, AIP1, apoptotic regulator in the membrane of the endoplasmic reticulum, ARL-6-interacting protein 1, ARL6IPaip-1, ARMER, KIAA0069ADP-ribosylation factor-like protein 6-interacting protein 1 |
|---|
| Gene, Accession # | ARL6IP1, Gene ID: 23204, Accession: Q15041, SwissProt: Q15041 |
|---|
| Catalog # | NBP1-91681 |
|---|
| Price | |
|---|
| Order / More Info | ARMER Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|