| Edit |   |
| Antigenic Specificity | DDX26B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DDX26B Antibody from Novus Biologicals is a rabbit polyclonal antibody to DDX26B. This antibody reacts with human. The DDX26B Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human DDX26B. Peptide sequence ASTEPEQLGSVPTDESAITQMCEVTGGRSYCVRTQRMLNQCLESLVQKVQ. |
| Other Names | DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 26B |
| Gene, Accession # | DDX26B, Gene ID: 203522, Accession: NP_872346, SwissProt: NP_872346 |
| Catalog # | NBP1-80205-20ul |
| Price | |
| Order / More Info | DDX26B Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |