| Edit |   |
|---|
| Antigenic Specificity | DDX26B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DDX26B Antibody from Novus Biologicals is a rabbit polyclonal antibody to DDX26B. This antibody reacts with human. The DDX26B Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human DDX26B. Peptide sequence ASTEPEQLGSVPTDESAITQMCEVTGGRSYCVRTQRMLNQCLESLVQKVQ. |
|---|
| Other Names | DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 26B |
|---|
| Gene, Accession # | DDX26B, Gene ID: 203522, Accession: NP_872346, SwissProt: NP_872346 |
|---|
| Catalog # | NBP1-80205 |
|---|
| Price | |
|---|
| Order / More Info | DDX26B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|