| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DDX3Y |
|---|
| Clone | 2D7 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DDX3Y Antibody (2D7) from Novus Biologicals is a mouse monoclonal antibody to DDX3Y. This antibody reacts with human, mouse. The DDX3Y Antibody (2D7) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | DDX3Y (NP_004651, 1 a.a. - 80 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSHVVVKNDPELDQQLANLDLNSEKQSGGASTASKGRYIPPHLRNREASKGFHDKDSSGWSCSKDKDAYSSFGSRDSRGK |
|---|
| Other Names | ATP-dependent RNA helicase DDX3Y, DBYEC 3.6.4.13, DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, Y-linked, DEAD box protein 3, Y-chromosomal, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide, Y chromosome, EC 3.6.1 |
|---|
| Gene, Accession # | DDX3Y, Gene ID: 8653, Accession: NP_004651, SwissProt: NP_004651 |
|---|
| Catalog # | H00008653-M01 |
|---|
| Price | |
|---|
| Order / More Info | DDX3Y Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|