| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RACK1/GNB2L1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, invertebrate |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RACK1/GNB2L1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RACK1/GNB2L1. This antibody reacts with human, invertebrate. The RACK1/GNB2L1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. This product is specific to Subunit or Isoform: beta-2-like 1 |
|---|
| Immunogen | Synthetic peptides corresponding to GNB2L1(guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1) The peptide sequence was selected from the N terminal of GNB2L1 (NP_006089). Peptide sequence ISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVL |
|---|
| Other Names | guanine nucleotide binding, guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1, Receptor for activated C kinase, Receptor for Activated C Kinase 1 |
|---|
| Gene, Accession # | GNB2L1, Gene ID: 10399, Accession: P63244, SwissProt: P63244 |
|---|
| Catalog # | NBP1-58959 |
|---|
| Price | |
|---|
| Order / More Info | RACK1/GNB2L1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24374472 |
|---|
| 产品资料 |
|
|