| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RACK1/GNB2L1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RACK1/GNB2L1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RACK1/GNB2L1. This antibody reacts with human, mouse, rat. The RACK1/GNB2L1 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:CVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDG |
|---|
| Other Names | guanine nucleotide binding, guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1, Receptor for activated C kinase, Receptor for Activated C Kinase 1 |
|---|
| Gene, Accession # | GNB2L1, Gene ID: 10399, Accession: P63244, SwissProt: P63244 |
|---|
| Catalog # | NBP1-83356 |
|---|
| Price | |
|---|
| Order / More Info | RACK1/GNB2L1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 21935400 |
|---|
| 产品资料 |
|
|