| 产品详情 |
| Edit |   |
| Antigenic Specificity | NFAT5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NFAT5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NFAT5. This antibody reacts with human. The NFAT5 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human NFAT5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SMWMEDSPSNFSNMSTSSYNDNTEVPRKSRKRNPKQRPGVKRRDCEESNMDIFDADSAKAPHYVLSQLTTDNKGNSKAGNGT |
| Other Names | EC 3.6.1, EC 3.6.3.14, KIAA0827glutamine rich protein H65, NF-AT5NFAT-like protein 1, NFATL1, NFATZ, nuclear factor of activated T-cells 5, tonicity-responsive, OREBP, osmotic response element-binding protein, T-cell transcription factor NFAT5, TonE-binding protein, TonEBP, TONEBPnuclear factor of activated T-cells 5, Tonicity-responsive enhancer-binding protein |
| Gene, Accession # | NFAT5, Gene ID: 10725 |
| Catalog # | NBP2-49612 |
| Price | |
| Order / More Info | NFAT5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|