| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NFATC2IP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NFATC2IP Antibody from Novus Biologicals is a rabbit polyclonal antibody to NFATC2IP. This antibody reacts with human. The NFATC2IP Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human NFATC2IP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SPWKTKLRTKDKEEKKKTEFLDLDNSPLSPPSPRTKSRTHTRALKKLSEVNKRLQDLRSCLSPKPPQGQEQQGQEDEVVLVE |
|---|
| Other Names | 45 kDa NF-AT-interacting protein, ESC2, FLJ14639, MGC126790, MGC138387, NFATC2-interacting protein, NIP4545 kDa NFAT-interacting protein, Nuclear factor of activated T-cells, cytoplasmic 2-interacting protein, nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2interacting protein, RAD60 |
|---|
| Gene, Accession # | NFATC2IP, Gene ID: 84901 |
|---|
| Catalog # | NBP2-58210 |
|---|
| Price | |
|---|
| Order / More Info | NFATC2IP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|