| Edit |   |
|---|
| Antigenic Specificity | Peripherin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Peripherin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Peripherin. This antibody reacts with human. The Peripherin Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Peripherin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EESRISVPVHSFASLNIKTTVPEVEPPQDSHSRKTVLIKTI |
|---|
| Other Names | Neurofilament 4, neurofilament 4 (57kD), peripherin, PRPH1NEF4 |
|---|
| Gene, Accession # | PRPH, Gene ID: 5630, Accession: P41219, SwissProt: P41219 |
|---|
| Catalog # | NBP2-39008 |
|---|
| Price | |
|---|
| Order / More Info | Peripherin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|