| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Glutaminase |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Glutaminase Antibody from Novus Biologicals is a rabbit polyclonal antibody to Glutaminase. This antibody reacts with human, mouse. The Glutaminase Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse Glutaminase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGL |
|---|
| Other Names | AAD20, EC 3.5.1.2, GLS1DKFZp686O15119, glutaminase, glutaminase C, glutaminase kidney isoform, mitochondrial, glutaminase, phosphate-activated, K-glutaminase, KIAA0838FLJ10358, L-glutamine amidohydrolase |
|---|
| Gene, Accession # | GLS, Gene ID: 2744 |
|---|
| Catalog # | NBP1-89766 |
|---|
| Price | |
|---|
| Order / More Info | Glutaminase Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25798620 |
|---|
| 产品资料 |
|
|