| 产品详情 |
| Edit |   |
| Antigenic Specificity | Glutaminase |
| Clone | 5C4 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2a kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Glutaminase Antibody (5C4) from Novus Biologicals is a mouse monoclonal antibody to Glutaminase. This antibody reacts with human. The Glutaminase Antibody (5C4) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
| Immunogen | GLS (NP_055720 580 a.a. - 669 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EQRDYDSRTALHVAAAEGHVEVVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL |
| Other Names | AAD20, EC 3.5.1.2, GLS1DKFZp686O15119, glutaminase, glutaminase C, glutaminase kidney isoform, mitochondrial, glutaminase, phosphate-activated, K-glutaminase, KIAA0838FLJ10358, L-glutamine amidohydrolase |
| Gene, Accession # | GLS, Gene ID: 2744, Accession: NP_055720, SwissProt: NP_055720 |
| Catalog # | H00002744-M01 |
| Price | |
| Order / More Info | Glutaminase Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 18317946, 19995960, 22228304, 23353822, 24060653, 25700560 |
| 产品资料 |
|
|