| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RNF40 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RNF40 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RNF40. This antibody reacts with human. The RNF40 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human RNF40 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GTTTTTTSVKKEELVPSEEDFQGITPGAQGPSSRGREPEARPKRELREREGPSLGPP |
|---|
| Other Names | 95 kDa retinoblastoma-associated protein, BRE1-B, BRE1BMGC13051, EC 6.3.2,95 kDa retinoblastoma protein binding protein, EC 6.3.2.-, KIAA0661BRE1 E3 ubiquitin ligase homolog B, Rb-associated protein, RBP95E3 ubiquitin-protein ligase BRE1B, ring finger protein 40DKFZp686K191, STARING |
|---|
| Gene, Accession # | RNF40, Gene ID: 9810 |
|---|
| Catalog # | NBP2-54968 |
|---|
| Price | |
|---|
| Order / More Info | RNF40 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|