| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | O-GlcNAc Transferase p110 subunit |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The O-GlcNAc Transferase p110 subunit Antibody from Novus Biologicals is a rabbit polyclonal antibody to O-GlcNAc Transferase p110 subunit. This antibody reacts with human, mouse, rat. The O-GlcNAc Transferase p110 subunit Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat O-GlcNAc Transferase p110 subunit antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWA |
|---|
| Other Names | EC 2.4.1, EC 2.4.1.255, FLJ23071, HRNT1, MGC22921, O-GLCNAC, O-GlcNAc transferase p110 subunit, O-GlcNAc transferase subunit p110, O-linked N-acetylglucosamine (GlcNAc) transferase(UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase), O-linked N-acetylglucosamine transferase 110 kDa subunit, UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDasubunit, uridinediphospho-N-acetylglucosamine:polypeptide beta-N-acetylglucosaminyltransferase |
|---|
| Gene, Accession # | OGT, Gene ID: 8473 |
|---|
| Catalog # | NBP1-89845 |
|---|
| Price | |
|---|
| Order / More Info | O-GlcNAc Transferase p110 subunit Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|