| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EYS/RP25 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, zebrafish |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in ICC/IF reported in scientific literature (PMID 27737822). IHC-Fr reported in the scientific literature (PMID: 30052645). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EYS/RP25 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EYS/RP25. This antibody reacts with human, zebrafish. The EYS/RP25 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen. Specificity of human, zebrafish EYS/RP25 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CECTSGWTGQNCSEEINECDSDPCMNGGLCHESTIPGQFVCLCPPLYTGQFCHQRYNLCDLLHNPCR |
|---|
| Other Names | C6orf178, C6orf179, C6orf180, dJ22I17.2, dJ303F19.1, EGFL10, EGFL11, EGF-like-domain, multiple 10, EGF-like-domain, multiple 11, eyes shut homolog (Drosophila), protein spacemaker homolog |
|---|
| Gene, Accession # | EYS, Gene ID: 346007 |
|---|
| Catalog # | NBP1-90038 |
|---|
| Price | |
|---|
| Order / More Info | EYS/RP25 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 27737822, 30052645 |
|---|
| 产品资料 |
|
|