| Edit |   |
| Antigenic Specificity | EZFIT/ZNF71 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The EZFIT/ZNF71 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EZFIT/ZNF71. This antibody reacts with human. The EZFIT/ZNF71 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | Synthetic peptide directed towards the middle region of human ZNF71. Peptide sequence RCGQCGKSFIKNSSLTVHQRIHTGEKPYRCGECGKTFSRNTNLTRHLRIH. |
| Other Names | endothelial zinc finger protein induced by tumor necrosis factor alpha, Kruppel-related zinc finger protein, zinc finger protein 71 (Cos26), zinc finger protein 71EZFITCos26 |
| Gene, Accession # | ZNF71, Gene ID: 58491, Accession: NP_067039, SwissProt: NP_067039 |
| Catalog # | NBP1-80358-20ul |
| Price | |
| Order / More Info | EZFIT/ZNF71 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |