| Edit |   |
| Antigenic Specificity | OLFML1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The OLFML1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to OLFML1. This antibody reacts with human. The OLFML1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to OLFML1(olfactomedin-like 1) The peptide sequence was selected from the middle region of OLFML1. Peptide sequence LCGVLYVVYSTGGQGPHRITCIYDPLGTISEEDLPNLFFPKRPRSHSMIH. |
| Other Names | MVAL564, olfactomedin-like 1, olfactomedin-like protein 1, UNQ564 |
| Gene, Accession # | OLFML1, Gene ID: 283298, Accession: Q6UWY5, SwissProt: Q6UWY5 |
| Catalog # | NBP1-57963-20ul |
| Price | |
| Order / More Info | OLFML1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |