| Edit |   |
|---|
| Antigenic Specificity | OLFML2A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The OLFML2A Antibody from Novus Biologicals is a rabbit polyclonal antibody to OLFML2A. This antibody reacts with human. The OLFML2A Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to OLFML2A(olfactomedin-like 2A) The peptide sequence was selected from the N terminal of OLFML2A. Peptide sequence EDFYTVETVSSGTDCRCSCTAPPSSLNPCENEWKMEKLKKQAPELLKLQS. |
|---|
| Other Names | FLJ00237, olfactomedin-like 2A, olfactomedin-like protein 2A, photomedin-1, PRO34319 |
|---|
| Gene, Accession # | OLFML2A, Gene ID: 169611, Accession: Q68BL7, SwissProt: Q68BL7 |
|---|
| Catalog # | NBP1-56749-20ul |
|---|
| Price | |
|---|
| Order / More Info | OLFML2A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|