| 产品详情 |
| Edit |   |
| Antigenic Specificity | SHIP2/INPPL1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. IHC reported in scientific literature (PMID: 29802388). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SHIP2/INPPL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SHIP2/INPPL1. This antibody reacts with human. The SHIP2/INPPL1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SHIP2/INPPL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TLGELIGLYAQPNQGLVCALLLPVEGEREPDPPDDRDASDGEDEKPPLPPRSGSTSISAPTGPSSPLPAPETPTAPAAESAPNGLST |
| Other Names | EC 3.1.3, EC 3.1.3.n1, inositol polyphosphate phosphatase-like 1, Inositol polyphosphate phosphatase-like protein 1, INPPL-1, phosphatidylinositol-34,5-trisphosphate 5-phosphatase 2, Protein 51C, SH2 domain-containing inositol phosphatase 2, SH2 domain-containing inositol-5'-phosphatase 2, SHIP-2, SHIP251C protein |
| Gene, Accession # | INPPL1, Gene ID: 3636 |
| Catalog # | NBP1-87046 |
| Price | |
| Order / More Info | SHIP2/INPPL1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 29802388 |
| 产品资料 |
|
|