| Edit |   |
| Antigenic Specificity | SHISA5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SHISA5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SHISA5. This antibody reacts with human. The SHISA5 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to SCOTIN The peptide sequence was selected from the middle region of SCOTIN. Peptide sequence CAVPEASVPASVEPVEQLGSALRFRPGYNDPMSGFGATLAVGLTIFVLSV. |
| Other Names | protein shisa-5, Putative NF-kappa-B-activating protein 120, Scotin, SCOTINhShisa5, shisa homolog 5 (Xenopus laevis) |
| Gene, Accession # | SHISA5, Gene ID: 51246, Accession: Q8N114, SwissProt: Q8N114 |
| Catalog # | NBP1-59053-20ul |
| Price | |
| Order / More Info | SHISA5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |