| Edit |   |
|---|
| Antigenic Specificity | SHISA5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SHISA5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SHISA5. This antibody reacts with human. The SHISA5 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SCOTIN The peptide sequence was selected from the middle region of SCOTIN. Peptide sequence CAVPEASVPASVEPVEQLGSALRFRPGYNDPMSGFGATLAVGLTIFVLSV. |
|---|
| Other Names | protein shisa-5, Putative NF-kappa-B-activating protein 120, Scotin, SCOTINhShisa5, shisa homolog 5 (Xenopus laevis) |
|---|
| Gene, Accession # | SHISA5, Gene ID: 51246, Accession: Q8N114, SwissProt: Q8N114 |
|---|
| Catalog # | NBP1-59053 |
|---|
| Price | |
|---|
| Order / More Info | SHISA5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|