| Edit |   |
| Antigenic Specificity | HEL-206 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The HEL-206 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HEL-206. This antibody reacts with human. The HEL-206 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to C12ORF40 The peptide sequence was selected from the N terminal of C12ORF40. Peptide sequence ENCSFTPSSFSVELPSNRHISKLNFTSGIAPTPQKLAYEKKQNDQRSTVN. |
| Other Names | chromosome 12 open reading frame 40, FLJ40126, hypothetical protein LOC283461 |
| Gene, Accession # | C12ORF40, Gene ID: 283461, Accession: Q86WS4, SwissProt: Q86WS4 |
| Catalog # | NBP1-56758 |
| Price | |
| Order / More Info | HEL-206 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |