| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Hemoglobin A1c |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Hemoglobin A1c Antibody from Novus Biologicals is a rabbit polyclonal antibody to Hemoglobin A1c. This antibody reacts with human. The Hemoglobin A1c Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Hemoglobin A1c antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a Recombinant Protein corresponding to amino acids: MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSF |
|---|
| Other Names | alpha one globin, alpha-1 globin, alpha-1-globin, alpha-globin, CD31, HbA1c, hemoglobin alpha 1 globin chain, Hemoglobin alpha chain, hemoglobin alpha-1 chain, hemoglobin subunit alpha, hemoglobin, alpha 1, MGC126895, MGC126897 |
|---|
| Gene, Accession # | HBA1, Gene ID: 3039 |
|---|
| Catalog # | NBP2-54711 |
|---|
| Price | |
|---|
| Order / More Info | Hemoglobin A1c Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|