| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PDP2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PDP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PDP2. This antibody reacts with human. The PDP2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human PDP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VPPTLNSSPCGGFTLCKAYRHTSTEEDDFHLQLSPEQINEVLRAGETTHKILDLESRVPNS |
|---|
| Other Names | EC 3.1.3, EC 3.1.3.43, KIAA1348[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial, PDP 2, PDPC 2, PPM2C2, protein phosphatase 2C, magnesium-dependent, catalytic subunit 2, Pyruvate dehydrogenase phosphatase catalytic subunit 2, pyruvate dehydrogenase phosphatase isoenzyme 2, pyruvate dehydrogenase phosphatase, catalytic subunit 2, pyruvate dehyrogenase phosphatase catalytic subunit 2 |
|---|
| Gene, Accession # | PDP2, Gene ID: 57546 |
|---|
| Catalog # | NBP2-57082 |
|---|
| Price | |
|---|
| Order / More Info | PDP2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|