| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PDP2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PDP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PDP2. This antibody reacts with human. The PDP2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PDP2(pyruvate dehyrogenase phosphatase catalytic subunit 2) The peptide sequence was selected from the middle region of PDP2. Peptide sequence CRAILGVQEDNGMWSCLPLTRDHNAWNQAELSRLKREHPESEDRTIIMED. |
|---|
| Other Names | EC 3.1.3, EC 3.1.3.43, KIAA1348[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial, PDP 2, PDPC 2, PPM2C2, protein phosphatase 2C, magnesium-dependent, catalytic subunit 2, Pyruvate dehydrogenase phosphatase catalytic subunit 2, pyruvate dehydrogenase phosphatase isoenzyme 2, pyruvate dehydrogenase phosphatase, catalytic subunit 2, pyruvate dehyrogenase phosphatase catalytic subunit 2 |
|---|
| Gene, Accession # | PDP2, Gene ID: 57546, Accession: Q9P2J9, SwissProt: Q9P2J9 |
|---|
| Catalog # | NBP1-55463-20ul |
|---|
| Price | |
|---|
| Order / More Info | PDP2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|