| Edit |   |
|---|
| Antigenic Specificity | Transgelin-3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Transgelin-3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Transgelin-3. This antibody reacts with mouse. The Transgelin-3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to the N terminal of Transgelin-3. Immunizing peptide sequence WLMDGTVLCKLINSLYPPGQEPIPKISESKMAFKQMEQISQFLKAAEVYG. |
|---|
| Other Names | Neuronal protein NP25, NP22NP25Neuronal protein 22, transgelin 3, transgelin-3 |
|---|
| Gene, Accession # | TAGLN3, Gene ID: 29114, Accession: Q9R1Q8 |
|---|
| Catalog # | NBP1-74167-20ul |
|---|
| Price | |
|---|
| Order / More Info | Transgelin-3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|