| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Transgelin/TAGLN/SM22 alpha |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. IHC reported in scientific literature (PMID: 25706627). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Transgelin/TAGLN/SM22 alpha Antibody from Novus Biologicals is a rabbit polyclonal antibody to Transgelin/TAGLN/SM22 alpha. This antibody reacts with human. The Transgelin/TAGLN/SM22 alpha Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Transgelin/TAGLN/SM22 alpha antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQV |
|---|
| Other Names | DKFZp686P11128, Protein WS3-10, SM2222 kDa actin-binding protein, SMCCDKFZp686B01212, Smooth muscle protein 22-alpha, TAGLN1, transgelin, transgelin variant 2, WS3-10SM22-alpha |
|---|
| Gene, Accession # | TAGLN, Gene ID: 6876 |
|---|
| Catalog # | NBP1-87981 |
|---|
| Price | |
|---|
| Order / More Info | Transgelin/TAGLN/SM22 alpha Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25706627 |
|---|
| 产品资料 |
|
|