| 产品详情 |
| Edit |   |
| Antigenic Specificity | IL-37/IL-1F7 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The IL-37/IL-1F7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IL-37/IL-1F7. This antibody reacts with human. The IL-37/IL-1F7 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human IL-37/IL-1F7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ENSGVKMGSEDWEKDEPQCCLEDPAVSPLEPGPSLPAMNFVHTSPKVKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALA |
| Other Names | FIL1, FIL1(ZETA), FIL1ZFIL1 zeta, IL-1F7IL-1 zeta, IL1H4IL1F7 (canonical product IL-1F7b), IL-1H4IL-1F7b (IL-1H4, IL-1H, IL-1RP1), IL-1RP1IL-1X protein, IL1RP1interleukin 1 family member 7, IL-1X, interleukin 1 family, member 7 (zeta), interleukin 1, zeta, interleukin-1 family member 7, Interleukin-1 homolog 4, interleukin-1 superfamily z, Interleukin-1 zeta, Interleukin-1-related protein |
| Gene, Accession # | IL37, Gene ID: 27178, Accession: Q9NZH6, SwissProt: Q9NZH6 |
| Catalog # | NBP2-34208 |
| Price | |
| Order / More Info | IL-37/IL-1F7 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|