| Edit |   |
|---|
| Antigenic Specificity | IL-38/IL-1F10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IL-38/IL-1F10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IL-38/IL-1F10. This antibody reacts with human. The IL-38/IL-1F10 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human IL-38/IL-1F10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: YYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICTLPNRGLDRTKVPIFLGIQGGSRCLACVETEE |
|---|
| Other Names | interleukin 1 family, member 10 (theta), UNQ6119/PRO20041 |
|---|
| Gene, Accession # | IL1F10, Gene ID: 84639, Accession: Q8WWZ1, SwissProt: Q8WWZ1 |
|---|
| Catalog # | NBP2-31798 |
|---|
| Price | |
|---|
| Order / More Info | IL-38/IL-1F10 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|