| Edit |   |
| Antigenic Specificity | IL-38/IL-1F10 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The IL-38/IL-1F10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IL-38/IL-1F10. This antibody reacts with human. The IL-38/IL-1F10 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human IL1F10. Peptide sequence SRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEA. |
| Other Names | interleukin 1 family, member 10 (theta), UNQ6119/PRO20041 |
| Gene, Accession # | IL1F10, Gene ID: 84639, Accession: NP_115945, SwissProt: NP_115945 |
| Catalog # | NBP1-91501-20ul |
| Price | |
| Order / More Info | IL-38/IL-1F10 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |