| 产品详情 |
| Edit |   |
| Antigenic Specificity | ASPRV1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, canine |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID 28249031). |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ASPRV1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ASPRV1. This antibody reacts with human, canine. The ASPRV1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, canine ASPRV1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GKLKLKAQFLVANASAEEAIIGTDVLQDHNAILDFEHRTCTLKGKKFRLLPVGGSLEDEFDLELIEEDPSSEEGRQELSH |
| Other Names | aspartic peptidase, retroviral-like 1, EC 3.4.23.-, FLJ25084, retroviral-like aspartic protease 1, SASPaseMUNO, SASPTAPS, Skin aspartic protease, Skin-specific retroviral-like aspartic protease, Taps, TPA-inducible aspartic proteinase-like protein |
| Gene, Accession # | ASPRV1, Gene ID: 151516, Accession: Q53RT3, SwissProt: Q53RT3 |
| Catalog # | NBP2-33981 |
| Price | |
| Order / More Info | ASPRV1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 28249031 |
| 产品资料 |
|
|