| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ASRGL1 |
|---|
| Clone | CL1679 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 |
|---|
| Format | Protein A purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ASRGL1 Antibody (CL1679) from Novus Biologicals is a mouse monoclonal antibody to ASRGL1. This antibody reacts with human. The ASRGL1 Antibody (CL1679) has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ASRGL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MDGKDLSAGAVSAVQCIANPIKLARLVMEKTPHCFLTDQGAAQFAAAMGVPEIPGEKLVTERNKKRLEKEKHEKGAQKTDCQ |
|---|
| Other Names | ALP1, ALPL-asparagine amidohydrolase, asparaginase like 1, asparaginase-like 1 protein, Asparaginase-like protein 1, CRASH, EC 3.5.1.1, FLJ22316, L-asparaginase |
|---|
| Gene, Accession # | ASRGL1, Gene ID: 80150, Accession: Q7L266, SwissProt: Q7L266 |
|---|
| Catalog # | NBP2-42378 |
|---|
| Price | |
|---|
| Order / More Info | ASRGL1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|