| Edit |   |
|---|
| Antigenic Specificity | MPP7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MPP7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MPP7. This antibody reacts with human. The MPP7 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to MPP7(membrane protein, palmitoylated 7 (MAGUK p55 subfamily member 7)) The peptide sequence was selected from the N terminal of MPP7. Peptide sequence MPALSTGSGSDTGLYELLAALPAQLQPHVDSQEDLTFLWDMFGEKSLHSL. |
|---|
| Other Names | FLJ32798, MAGUK p55 subfamily member 7, membrane protein, palmitoylated 7 (MAGUK p55 subfamily member 7) |
|---|
| Gene, Accession # | MPP7, Gene ID: 143098, Accession: Q5T2T1, SwissProt: Q5T2T1 |
|---|
| Catalog # | NBP1-53081-20ul |
|---|
| Price | |
|---|
| Order / More Info | MPP7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|