| 产品详情 |
| Edit |   |
| Antigenic Specificity | HEY1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The HEY1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HEY1. This antibody reacts with human. The HEY1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human HEY1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQG |
| Other Names | basic helix-loop-helix protein OAF1, BHLHb31, Cardiovascular helix-loop-helix factor 2, CHF-2, CHF2hHRT1, Class B basic helix-loop-helix protein 31, Hairy and enhancer of split-related protein 1, hairy/enhancer-of-split related with YRPW motif 1, hairy/enhancer-of-split related with YRPW motif protein 1, Hairy-related transcription factor 1, HERP2HES-related repressor protein 1, HESR-1, HESR1MGC1274, HES-related repressor protein 2, HRT1, HRT-1OAF1 |
| Gene, Accession # | HEY1, Gene ID: 23462 |
| Catalog # | NBP2-47436 |
| Price | |
| Order / More Info | HEY1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|