| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HEY2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HEY2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HEY2. This antibody reacts with human. The HEY2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human HEY2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKK |
|---|
| Other Names | BHLHB32, bHLHb32HES-related repressor protein 2, cardiovascular basic helix-loop-helix factor 1, Cardiovascular helix-loop-helix factor 1, CHF1, Class B basic helix-loop-helix protein 32, GRLGRIDLOCK, Hairy and enhancer of split-related protein 2, hairy/enhancer-of-split related with YRPW motif 2, hairy/enhancer-of-split related with YRPW motif protein 2, Hairy-related transcription factor 2, hCHF1, HERP, HERP1hHRT2, HESR2, HESR-2, HES-related repressor protein 1, HRT2, HRT-2, MGC10720, Protein gridlock homolog |
|---|
| Gene, Accession # | HEY2, Gene ID: 23493 |
|---|
| Catalog # | NBP2-57809 |
|---|
| Price | |
|---|
| Order / More Info | HEY2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|