| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Hey L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. Recommended conditions for IHC,Retrieval method: HIER pH6 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Hey L Antibody from Novus Biologicals is a rabbit polyclonal antibody to Hey L. This antibody reacts with human. The Hey L Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKHRGII |
|---|
| Other Names | BHLHB33, bHLHb33hHeyL, Class B basic helix-loop-helix protein 33, hairy/enhancer-of-split related with YRPW motif 3, hairy/enhancer-of-split related with YRPW motif-like, hairy/enhancer-of-split related with YRPW motif-like protein, Hairy-related transcription factor 3, HEY3, HEY-like protein, hHRT3, HRT3, HRT-3, MGC12623 |
|---|
| Gene, Accession # | HEYL, Gene ID: 26508 |
|---|
| Catalog # | NBP2-69029 |
|---|
| Price | |
|---|
| Order / More Info | Hey L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|