| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MST2/STK3 |
|---|
| Clone | 1B3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MST2/STK3 Antibody (1B3) from Novus Biologicals is a mouse monoclonal antibody to MST2/STK3. This antibody reacts with human, mouse. The MST2/STK3 Antibody (1B3) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | STK3 (NP_006272.1 253 a.a. - 350 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAKRHEEQQRELEEEEENSDEDELDSHTMVKTSVESVGTMRATSTMSEGAQTM |
|---|
| Other Names | EC 2.7.11, FLJ90748, KRS1, Mammalian STE20-like protein kinase 2, MST-2, MST2EC 2.7.11.1, serine/threonine kinase 3, serine/threonine kinase 3 (STE20 homolog, yeast), serine/threonine kinase 3 (Ste20, yeast homolog), serine/threonine-protein kinase 3, Serine/threonine-protein kinase Krs-1, STE20-like kinase MST2 |
|---|
| Gene, Accession # | STK3, Gene ID: 6788, Accession: NP_006272, SwissProt: NP_006272 |
|---|
| Catalog # | H00006788-M11 |
|---|
| Price | |
|---|
| Order / More Info | MST2/STK3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|