| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATP6V0D1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ATP6V0D1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATP6V0D1. This antibody reacts with human. The ATP6V0D1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ATP6V0D1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKL |
|---|
| Other Names | 32 kDa accessory protein, ATP6D, ATP6DV, ATPase, H+ transporting, lysosomal (vacuolar proton pump), member D, ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d isoform 1, ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1, FLJ43534, H(+)-transporting two-sector ATPase, subunit D, P39, Vacuolar proton pump subunit d 1, V-ATPase 40 kDa accessory protein, V-ATPase AC39 subunit, V-ATPase, subunit D, VATX, Vma6, VPATPDV-ATPase subunit d 1, V-type proton ATPase subunit d 1 |
|---|
| Gene, Accession # | ATP6V0D1, Gene ID: 9114 |
|---|
| Catalog # | NBP1-88893 |
|---|
| Price | |
|---|
| Order / More Info | ATP6V0D1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|