| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATP6V0D2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ATP6V0D2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATP6V0D2. This antibody reacts with human. The ATP6V0D2 Antibody has been validated for the following applications: Western Blot. This product is specific to Subunit or Isoform: d 2 |
|---|
| Immunogen | Synthetic peptides corresponding to ATP6V0D2(ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2) The peptide sequence was selected from the middle region of ATP6V0D2. Peptide sequence MNVLAFNRQFHYGVFYAYVKLKEQEIRNIVWIAECISQRHRTKINSYIPI |
|---|
| Other Names | ATP6D2, ATPase, H+ transporting, lysosomal 38kD, V0 subunit d isoform 2, ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d isoform 2, ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2, FLJ38708, Vacuolar proton pump subunit d 2, V-ATPase subunit d 2, VMA6, V-type proton ATPase subunit d 2 |
|---|
| Gene, Accession # | ATP6V0D2, Gene ID: 245972, Accession: Q8N8Y2, SwissProt: Q8N8Y2 |
|---|
| Catalog # | NBP1-54857 |
|---|
| Price | |
|---|
| Order / More Info | ATP6V0D2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|