| Edit |   |
|---|
| Antigenic Specificity | KIF3B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KIF3B Antibody from Novus Biologicals is a rabbit polyclonal antibody to KIF3B. This antibody reacts with human. The KIF3B Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to KIF3B (kinesin family member 3B) The peptide sequence was selected from the C terminal of KIF3B. Peptide sequence APKVQAALDAALQDEDEIQVDASSFESTANKKSKARPKSGRKSGSSSSSS. |
|---|
| Other Names | HH0048, KIAA0359Microtubule plus end-directed kinesin motor 3B, kinesin family member 3B, kinesin-like protein KIF3B |
|---|
| Gene, Accession # | KIF3B, Gene ID: 9371, Accession: O15066, SwissProt: O15066 |
|---|
| Catalog # | NBP1-58138 |
|---|
| Price | |
|---|
| Order / More Info | KIF3B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|