| Edit |   |
| Antigenic Specificity | KIFC3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The KIFC3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KIFC3. This antibody reacts with human. The KIFC3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to KIFC3(kinesin family member C3) The peptide sequence was selected from the C terminal of KIFC3 (NP_005541). Peptide sequence EHLEWEPACQTPQPSARAHSAPSSGTSSRPGSIRRKLQPSGKSRPLPV. |
| Other Names | DKFZp686D23201, FLJ34694, kinesin family member C3, kinesin-like protein KIFC3 |
| Gene, Accession # | KIFC3, Gene ID: 3801, Accession: Q9BVG8, SwissProt: Q9BVG8 |
| Catalog # | NBP1-58178-20ul |
| Price | |
| Order / More Info | KIFC3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |