| Edit |   |
|---|
| Antigenic Specificity | KIFC3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KIFC3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KIFC3. This antibody reacts with human. The KIFC3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to KIFC3(kinesin family member C3) The peptide sequence was selected from the C terminal of KIFC3 (NP_005541). Peptide sequence EHLEWEPACQTPQPSARAHSAPSSGTSSRPGSIRRKLQPSGKSRPLPV. |
|---|
| Other Names | DKFZp686D23201, FLJ34694, kinesin family member C3, kinesin-like protein KIFC3 |
|---|
| Gene, Accession # | KIFC3, Gene ID: 3801, Accession: Q9BVG8, SwissProt: Q9BVG8 |
|---|
| Catalog # | NBP1-58178 |
|---|
| Price | |
|---|
| Order / More Info | KIFC3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|