| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CCL18/PARC |
|---|
| Clone | 2C6 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunoprecipitation. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CCL18/PARC Antibody (2C6) from Novus Biologicals is a mouse monoclonal antibody to CCL18/PARC. This antibody reacts with human. The CCL18/PARC Antibody (2C6) has been validated for the following applications: Western Blot, ELISA, Immunoprecipitation. |
|---|
| Immunogen | CCL18 (NP_002979, 21 a.a. - 89 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA |
|---|
| Other Names | Alternative macrophage activation-associated CC chemokine 1, AMAC1CC chemokine ligand 18, AMAC-1Small-inducible cytokine A18, chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated), CKb7, DC-CK1CC chemokine PARC, DCCK1Macrophage inflammatory protein 4, Dendritic cell chemokine 1, MIP4, MIP-4C-C motif chemokine 18, PARCPulmonary and activation-regulated chemokine, SCYA18chemokine (C-C), dendritic, small inducible cytokine A18, small inducible cytokine subfamily A (Cys-Cys), member 18, pulmonary andactivation-regulated |
|---|
| Gene, Accession # | CCL18, Gene ID: 6362, Accession: NP_002979, SwissProt: NP_002979 |
|---|
| Catalog # | H00006362-M03 |
|---|
| Price | |
|---|
| Order / More Info | CCL18/PARC Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|