| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CCL17/TARC |
|---|
| Clone | 1F11 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA, Immunocytochemistry/Immunofluorescence. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CCL17/TARC Antibody (1F11) from Novus Biologicals is a mouse monoclonal antibody to CCL17/TARC. This antibody reacts with human. The CCL17/TARC Antibody (1F11) has been validated for the following applications: ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | CCL17 (NP_002978, 24 a.a. - 94 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS |
|---|
| Other Names | ABCD-2, CC chemokine TARC, C-C motif chemokine 17, chemokine (C-C motif) ligand 17, MGC138273, SCYA17MGC138271, small inducible cytokine subfamily A (Cys-Cys), member 17, Small-inducible cytokine A17, T cell-directed CC chemokine, TARCA-152E5.3, Thymus and activation-regulated chemokine |
|---|
| Gene, Accession # | CCL17, Gene ID: 6361, Accession: NP_002978, SwissProt: NP_002978 |
|---|
| Catalog # | H00006361-M02 |
|---|
| Price | |
|---|
| Order / More Info | CCL17/TARC Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|