| Edit |   |
| Antigenic Specificity | Cystatin-8 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Cystatin-8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cystatin-8. This antibody reacts with human. The Cystatin-8 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to CST8(cystatin 8 (cystatin-related epididymal specific)) The peptide sequence was selected from the middle region of CST8. Peptide sequence LKPVNASNANVKQCLWFAMQEYNKESEDKYVFLVVKTLQAQLQVTNLLEY. |
| Other Names | CRESCystatin-related epididymal spermatogenic protein, cystatin 8 (cystatin-related epididymal specific), cystatin-8, cystatin-related epididymal-specific |
| Gene, Accession # | CST8, Gene ID: 10047, Accession: O60676, SwissProt: O60676 |
| Catalog # | NBP1-57663-20ul |
| Price | |
| Order / More Info | Cystatin-8 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |