| Edit |   |
| Antigenic Specificity | Cystatin-9 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Cystatin-9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cystatin-9. This antibody reacts with human. The Cystatin-9 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human CST9. Peptide sequence: LRVLSSWREDSMDRKWRGKMVFSMNLQLRQTVCRKFEDDIDNCPFQESLE |
| Other Names | cystatin 9 (testatin) |
| Gene, Accession # | CST9, Gene ID: 128822, Accession: NP_001008693, SwissProt: NP_001008693 |
| Catalog # | NBP1-79739 |
| Price | |
| Order / More Info | Cystatin-9 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |