| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Cystatin B/Stefin B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Cystatin B/Stefin B Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cystatin B/Stefin B. This antibody reacts with human. The Cystatin B/Stefin B Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Cystatin B/Stefin B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELT |
|---|
| Other Names | CPI-B, CST6cystatin B (liver thiol proteinase inhibitor)10STFBcystatin-B, cystatin B (stefin B), EPM1, Liver thiol proteinase inhibitor, PME, stefin B, stefin-B |
|---|
| Gene, Accession # | CSTB, Gene ID: 1476 |
|---|
| Catalog # | NBP1-85430 |
|---|
| Price | |
|---|
| Order / More Info | Cystatin B/Stefin B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|