| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CCDC99 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CCDC99 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCDC99. This antibody reacts with human. The CCDC99 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CCDC99 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LQIATLLQMKGSQTEFEQQERLLAMLEQKNGEIKHLLGEIRNLEKFKNLYDSMESKPSVDSGTLEDNTYYTDLLQMKLDNLNKEIESTKGELS |
|---|
| Other Names | Arsenite-related gene 1 protein, coiled-coil domain containing 99, Coiled-coil domain-containing protein 99, FLJ20364, FLJ40690, hSpindly, protein Spindly, Rhabdomyosarcoma antigen MU-RMS-40.4A, rrhabdomyosarcoma antigen protein MU-RMS-40.4A, Spindly |
|---|
| Gene, Accession # | SPDL1, Gene ID: 54908 |
|---|
| Catalog # | NBP2-47518 |
|---|
| Price | |
|---|
| Order / More Info | CCDC99 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|