| Edit |   |
|---|
| Antigenic Specificity | CCDC74A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CCDC74A Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCDC74A. This antibody reacts with human. The CCDC74A Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to CCDC74A(coiled-coil domain containing 74A) The peptide sequence was selected from the middle region of CCDC74A. Peptide sequence FPKVSTKSLSKKCLSPPVAERAILPALKQTPKNNFAERQKRLQAMQKRRL. |
|---|
| Other Names | coiled-coil domain containing 74A, coiled-coil domain-containing protein 74A, FLJ40345 |
|---|
| Gene, Accession # | CCDC74A, Gene ID: 90557, Accession: Q96AQ1, SwissProt: Q96AQ1 |
|---|
| Catalog # | NBP1-56895-20ul |
|---|
| Price | |
|---|
| Order / More Info | CCDC74A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|